Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant E.coli 30S ribosomal protein S3 protein

Product Type : Recombinant Protein
Size : 1mg
Uniprot Num : P0A7V3
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation By similarity. Ref.7 Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp. Ref.7
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP086344Ba
Purity : 90%
Sequence : GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
Research Area : Others
Source : E.coli
Gene Names : rpsC/ b3314 /JW3276
Expression Region : 2-233aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 53.2kD
Protein Description : Full length
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
Top