Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant E.coli 50S ribosomal protein L27 protein

Product Type : Recombinant Protein
Size : 1mg
Uniprot NO. : P0A7L8
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Belongs to the ribosomal protein L27P family.
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP088844Ba
Purity : 90%
Sequence : AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE
Research Area : Others
Gene Names : rpmA/ b3185/ JW3152
Expression Region : 2-85aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 36.4kD
Protein Description : Full length
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
skype
Top