Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant E.coli 50S ribosomal protein L31 protein

Product Type : Recombinant Protein
Size : 1mg
Uniprot Num : P0A7M9
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Binds the 23S rRNA
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP088444Ba
Purity : 90%
Sequence : MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK
Research Area : Others
Source : E.coli
Gene Names : rpmE/ b3936 /JW3907
Expression Region : 1-70aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 35.3kD
Protein Description : Full length
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
Top