Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial

Code CSB-RP063694h(A4)
Size US$88
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
AHSG
Uniprot No.
Research Area
others
Alternative Names
59 kDa bone sialic acid-containing protein; A2HS; Aa2-066; AHS; Ahsg alpha-2-HS-glycoprotein; Ahsg; Alpha 2 HS Glycoprotein; Alpha 2 Z globulin; Alpha-2-HS-glycoprotein; Alpha-2-HS-glycoprotein chain B; Alpha-2-Z-globulin; Asialofetuin; Ba alpha 2 glycoprotein; Ba-alpha-2-glycoprotein; BSP; Countertrypin; Fetua; FETUA_HUMAN; Fetuin ; mouse; homolog of; Fetuin A; Fetuin-A; Glycoprotein PP63; HSGA; pp63
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-296aa
Target Protein Sequence
PHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
33.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.
Gene References into Functions
  1. Serum Fetuin-A levels in septic patients decreased significantly in the first 24 hours, followed by an insignificant increase at 72 hours. PMID: 29968890
  2. Considering the role of fetuin-A in tissue calcification and inflammation, higher serum fetuin-A levels should be measured in patients with basal ganglia calcification PMID: 29288724
  3. This review is focused on work that has been done regarding fetuin-A potential role(s) in tumor progression and sequelae of diabetes. [review] PMID: 30060600
  4. In conclusion, Fetuin A, vitamin D, and intact PTH levels were all associated with sarcopenia in this geriatric population. Among them, intact PTH specifically indicates patients with sarcopenic left ventricular hypertrophy. PMID: 28112206
  5. fetuin a to adiponectin ratio is more strongly associated with metabolic syndrome and its components than fetuin-A or adiponectin alone PMID: 28779425
  6. High levels of fetuin-A and TGFbeta1 reported in patients with axial spondyloarthropathies. PMID: 26799059
  7. fetuin-A can be an alternative marker for insulin resistance and cardiovascular risk in prepubertal children PMID: 28154244
  8. rs4917 T allele carriers had higher triglycerides (TG). This relationship was exaggerated in individuals with overweight and obesity. Dietary intake was significantly associated with TG in only those with heterozygosity at rs4917, suggesting that these individuals may be more susceptible to dietary interventions. PMID: 28858873
  9. Although there is mechanistic evidence for an effect of fetuin-A on insulin sensitivity and secretion, data from this study does not support a strong, relevant relationship between circulating fetuin-A and risk of diabetes type 2 in the general European population studied. PMID: 29523632
  10. In overweight-to-obese older men, exercise/weight loss therapy appears to increase plasma fetuin-A levels, which is related to improvements in aerobic capacity. PMID: 28770230
  11. Higher fetuin-A levels are associated with incident type 2 diabetes in both males and females. PMID: 29439057
  12. Data suggest that plasma fetuin-A levels are down-regulated in type 2 diabetes with peripheral arterial disease, irrespective of traditional cardiovascular risk factors; fetuin-A may be involved in lower extremity arterial calcification in type 2 diabetes. PMID: 27899247
  13. Data suggest that, in children with type I diabetes, serum levels of osteoprotegerin are up-regulated, serum levels of RANKL are unchanged, and serum levels of fetuin-A are down-regulated. (RANKL = receptor activator of nuclear factor kappa B ligand) PMID: 27028343
  14. Elevated levels of pentraxin-3, fetuin-A, CRP, ESR might play a role in the pathogenesis of rheumatoid arthritis. Levels of fetuin-A, insulin HOMA-IR, pentraxin-3, CRP and ESR were not associated with clinical severity of the rheumatoid arthritis. PMID: 27152709
  15. the studies demonstrate the impact of fetuin-A as significant node of growth, motility, and invasion signaling in glioblastomas that can be targeted for therapy. PMID: 27882696
  16. Lower plasma fetuin-A levels were associated with an increased risk of all-cause and CVD mortality in patients with coronary artery disease independently of traditional CVD risk factors. PMID: 28912366
  17. thus creates an inflammatory environment in the pancreatic islets that can become a possible cause behind pancreatic beta-cell dysfunction in chronic hyperlipidemic condition PMID: 28797566
  18. In kidney disease, low circulating Fet-A concentrations are associated with progressive aortic stiffening and calcification. [review] PMID: 27190332
  19. The over-secretion of alpha-2-Heremans-Schmid glycoprotein by visceral adipose tissue, the increased secretion of the active phosphorylated form by subcutaneous adipose tissuein obese animals, and the adipose-derived alpha-2-Heremans-Schmid glycoprotein capacity to inhibit the insulin pathway suggest the participation of adipose-derived alpha-2-Heremans-Schmid glycoprotein in the deleterious effects of obesity. PMID: 27738888
  20. AHSG can be used to distinguish between inflammatory bowel disease and irritable bowel syndrome patients or healthy controls while at the same time "predicting" complicated disease behavior, need for therapy escalation and surgery. PMID: 28210079
  21. Lower baseline fetuin A levels and the presence of VC were independently linked to higher risk of incident fractures in prevalent dialysis patients PMID: 27398932
  22. present whole-exome sequencing results of a large consanguineous family segregating APMR syndrome with seven affected family members. Our study revealed a novel predicted pathogenic, homozygous missense mutation in the AHSG (OMIM 138680) gene PMID: 28054173
  23. fetuin A positively predicts circulating fetuin B in gestational diabetes mellitus PMID: 28183456
  24. Predictive role of the hepatokine fetuin A as a noninvasive biomarker of hepatic steatosis in preoperative settings. Compared to non-NAFLD subjects fetuin A was increased in NAFLD (p = .009) and in NASH (p = .029). PMID: 26980291
  25. The rs4918 minor variant is associated with lower TNFalpha and adiponectin, higher leptin levels in healthy persons, and more favorable anthropomorphic parameters of obesity. The G allele was more frequent among lean than obese patients (RR=1.067, 95%CI=1.053-2.651, p=0.015). An association between BMI and rs4918 polymorphism was observed among patients without diabetes but not in diabetics. PMID: 27487851
  26. fetuin-A does not have a role in the overall risk of cardiovascular disease PMID: 27038419
  27. Significant disturbance in serum and urinary fetuin-A levels, which was related to renal functions, had occurred during HDMTX and persisted for at least 4 months after the consolidation. Serum and urine fetuin-A could be sensitive markers for subtle renal dysfunction in ALL children. PMID: 26268515
  28. Serum fetuin-A level is not associated with disease progression and death and does not enhance risk prediction in non-dialysis chronic kidney disease stages 3-5. PMID: 27334353
  29. Increased serum visfatin, fetuin-A, and PTX3 levels, and the presence of positive correlation between visfatin, fetuin-A, and Psoriasis area and severity index, probably reflect the inflammatory state and insulin resistance seen in psoriasis. PMID: 25867925
  30. peritoneal dialysis patients with heart failure have significantly lower fetuin-A levels PMID: 24990392
  31. Study showed that serum levels of Fetuin-A are linked to serum calcium homeostasis and AHSG genotype but not with coronary artery calcification severity in subjects without coronary vasculopathy. PMID: 26825086
  32. Serum fetuin-A concentrations are independently correlated with VEGF and CRP concentrations in T2DM patients with DR, but not in NDR subjects PMID: 26851648
  33. From infancy to aging: Biological and behavioral modifiers of Fetuin-A. PMID: 26740309
  34. Fetuin-A exerts the stimulatory effects on inflammatory responses in HUVECs, macrophage foam cell formation, and proliferation and collagen production in HASMCs, leading to the development of atherosclerosis. PMID: 26828753
  35. Common variants in the AHSG gene are strongly associated with fetuin-A levels, but their concurrent association with CHD risk in current prospective studies is inconsistent PMID: 26343871
  36. results indicated that the cis-regulatory expressional difference of AHSG is expected to occur at the level of transcription or splicing of mRNA PMID: 26549924
  37. Data suggest that serum fetuin-A (FETUA/AHSG) concentrations are signi fi cantly positively associated with serum VEGFA (vascular endothelial growth factor A) levels in patients with newly diagnosed type 2 diabetes. PMID: 26156593
  38. Reanalysis of a total of 47 MDS patients revealed biomarker candidates, with alpha-2-HS-glycoprotein and leucine-rich alpha-2-glycoprotein as the most promising candidates. PMID: 26448929
  39. AHSG is up-regulated in hypopharyngeal squamous cell carcinoma may be employed as a potential biomarker for its early diagnosis PMID: 26464644
  40. The T nucleotide in rs4917 of AHSG is associated with more favorable lipid status among healthy persons (i.e., lower low-density lipoprotein cholesterol) and anthropologic parameters of obesity in cohort 2. PMID: 25695715
  41. In this large sample of community-dwelling older adults, a small positive association between fetuin-A and areal BMD appeared attributable to confounding variables and we found no evidence of an association between fetuin-A and risk of clinical fracture. PMID: 25656814
  42. The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability. PMID: 26214492
  43. There are increased carotid intima-media thickness values, decreased fetuin-A levels, but unchanged ABI values in patients with normotensive COPD. PMID: 23799555
  44. Fetuin-A is a novel risk marker for coronary artery disease in asymptomatic young adults. PMID: 25679296
  45. These findings establish urinary Fetuin-A as a sensitive biomarker of the progression of autosomal dominant polycystic kidney disease. PMID: 25888842
  46. Report increased secretion of Fetuin A, LBP and HMGB-1 from subcutaneous adipose tissue in metabolic syndrome. PMID: 25978344
  47. The present study demonstrates that fetuin-A 742 (C/T) and 766 (C/G) genotypes may be risk factors for myocardial infarction in patients older than 40 years of age. PMID: 25815703
  48. serum concentrations significantly associated with elevated fatty liver index, ALT, and AST, the early indicators of nonalcoholic fatty liver disease PMID: 26426614
  49. Circulating fetuin-A could be a useful serum biomarker for predicting liver and vascular fibrosis progression in fatty liver disease patients. PMID: 25627311
  50. Data indicate that the effect of testosterone on fetuin-A (alpha-2-HS-glycoprotein, AHSG) mRNA levels was abrogated by silencing of the androgen receptor in HepG2 cells. PMID: 25011927

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Fetuin family
Tissue Specificity
Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
Database Links

HGNC: 349

OMIM: 138680

KEGG: hsa:197

STRING: 9606.ENSP00000393887

UniGene: Hs.324746

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*