Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
FKHL16; Forkhead box M1; Forkhead box protein M1; forkhead like 16; Forkhead-related protein FKHL16; FOX M1; Foxm1; FOXM1_HUMAN; FOXM1B; Hepatocyte nuclear factor 3 forkhead homolog 11; HFH-11; HFH11; HNF-3/fork-head homolog 11; HNF3; INS1; M phase phosphoprotein 2; M-phase phosphoprotein 2; MPHOSPH2; MPM-2 reactive phosphoprotein 2; MPP2; PIG29; TGT3; Transcription factor Trident; Trident; WIN; Winged-helix factor from INS-1 cells; Winged-helix factor from INS1 cells
Species
Homo sapiens (Human)
Expression Region
235-327aa
Target Protein Sequence
ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Dive into the study of Forkhead box protein M1 (FOXM1), a crucial transcription factor implicated in cell cycle regulation and cell proliferation, with our Recombinant Human FOXM1 protein. FOXM1, encoded by the FOXM1 gene, is a key player in the regulation of various cellular processes, including DNA damage response, angiogenesis, and metastasis, making it an essential focus in cancer research.
Our Recombinant Human FOXM1 protein is expressed in an E.coli system and covers the 235-327aa region of the full-length protein. The N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag facilitate efficient protein purification and detection in your experimental setup. This high-quality, partial-length FOXM1 protein boasts a purity greater than 90%, as validated by SDS-PAGE, providing you with a dependable research tool. Choose between liquid or lyophilized powder forms according to your laboratory needs and streamline your research endeavors.
