Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CA2D1_HUMAN; CACN A2; CACNA2; Cacna2d1; CACNL2A; Calcium channel L type alpha 2 polypeptide; Calcium channel voltage dependent alpha 2/delta subunit 1; CCHL2A; Dihydropyridine receptor alpha 2 subunit; Dihydropyridine sensitive L type calcium channel alpha 2/delta subunit; Dihydropyridine sensitive L type calcium channel subunits alpha 2/delta; L type calcium channel subunit alpha 2; MHS 3; MHS3; Voltage dependent calcium channel subunit alpha 2/delta 1; Voltage gated calcium channel subunit alpha 2/delta 1; Voltage-dependent calcium channel subunit delta-1; Voltage-gated calcium channel subunit alpha-2/delta-1
Species
Homo sapiens (Human)
Expression Region
528-668aa
Target Protein Sequence
QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human CACNA2D1 contains amino acids 528-668. The calculated molecular weight for this CACNA2D1 protein is 32.3 kDa. This CACNA2D1 protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of CACNA2D1, making it easier to detect and purify the CACNA2D1 recombinant protein in the later stages of expression and purification.
Voltage-dependent calcium channel subunit alpha-2/delta-1 (CACNA2D1) is primarily studied in the fields of neurobiology and neuropharmacology. Within nerve cells, CACNA2D1 participates in the formation and regulation of voltage-dependent calcium channels, playing a crucial role in neural signal transmission and neuronal excitability. Research indicates that CACNA2D1 is associated with certain neurological disorders such as epilepsy and neuropathic pain. Scientists are exploring its precise role in the pathogenesis of these diseases, aiming to provide new targets and strategies for their treatment. Additionally, the study of CACNA2D1 extends to the cardiovascular system, particularly its function in cardiac muscle cells. Its regulatory mechanisms in cardiovascular diseases and arrhythmias are also subjects of considerable interest.
