Recombinant Mouse Hepatitis A virus cellular receptor 1 homolog (Havcr1), partial

Code CSB-EP735580MO
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Havcr1
Uniprot No.
Research Area
Others
Alternative Names
Havcr1; Kim1; Tim1; Timd1; Hepatitis A virus cellular receptor 1 homolog; HAVcr-1; Kidney injury molecule 1; KIM-1; T cell immunoglobulin and mucin domain-containing protein 1; TIMD-1; T cell membrane protein 1; T-cell immunoglobulin mucin receptor 1; TIM-1; CD antigen CD365
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
22-237aa
Target Protein Sequence
YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHRVTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKVTFSLQVKPEIPTRPPTRPTTTRPTATGRPTTISTRSTHVPTSIRVSTSTPPTSTHTWTHKPEPTTFCPHETTAEVTGIPSHTPTDWNGTVTSSGDTWSNHTEAIPPGKPQKNPTKG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
27.6kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I have the following questions.Can you please advise?
My intention would be to use this item as a positive control to identify, by mass spectra, this mouse KIM-1 protein in urine samples.Do you have any established protocols for using this protein as standard?
Another question I have, as this protein is a glycoprotein that, at the renal level is cleaved from the membrane when the proximal tubule membrane is ruptured, would this protein work to find the cleaved product I want?

A:
Very nice to receive your inquiry. We use new code CSB-EP735580MO for this protein now. Please update your catalog.
The expreesion of CSB-RP171094m with N-terminal 6xHis-tagged is not very good. We have to re-develop this protein. The tag type will be determined during the production process, however, we will preferentially N-terminal 6xHis-tag. The MW and sequence info of CSB-EP735580MO with N-terminal 6xHis-tagged are as below.
1. The MW of the N-terminal 6xHis-tagged fusion protein= 27.6KD. The MW of the N-terminal 6xHis-tag is 4KD. The MW of the target protein is 23.6KD.
2. The complete sequence is as below. The sequence in front of "+" is the N-terminal 6xHis-tag sequence, and the sequence behind of "+" is the target protein sequence.

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRT+YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHRVTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKVTFSLQVKPEIPTRPPTRPTTTRPTATGRPTTISTRSTHVPTSIRVSTSTPPTSTHTWTHKPEPTTFCPHE


TTAEVTGIPSHTPTDWNGTVTSSGDTWSNHTEAIPPGKPQKNPTKG


3. This protein can be used as positive control in theory. We haven't tested the activity of this protein. CSB-EP735580MO is complete Extracellular Domain which includes Ig-like V-type domain and should have activity
in theory. According to uniprot info (http://www.uniprot.org/uniprot/Q96D42), for human KIM-1, the extracellular part of the protein can be cleaved and detected in urine and is in correlation with the expression in
the kidney. The mouse KIM-1 we provide is complete Extracellular Domain which should be the cleaved product which you want.
There is an N-glycosylation at position 208 that happens to be in the extracellular domain. The recombinant expression of E. coli will have no glycosylation modification, so the peak at this glycosylation site where you take our protein as a positive control will be different from the natural sample, and everything else will be exactly the same.

Target Background

Function
May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair.
Gene References into Functions
  1. findings show that TIM1 is not required for hepatitis A virus (HAV) replication and pathogenesis in permissive strains of mice, although it may facilitate early stages of infection by binding phosphatidylserine on the quasi-enveloped HAV surface PMID: 28874468
  2. findings provide evidence for the role of Tim-1 in the induction of a cytokine storm phenomenon and the pathogenesis of Ebola virus disease PMID: 28951472
  3. Cisplatin enhances kidney injury molecule-1 (Kim-1) gene expression in kidney S3 cells. PMID: 27591740
  4. By preventing ERK1/2 phosphorylation following renal injury, STAT3 phosphorylation is decreased, leading to less phosphorylated STAT3 within the nucleus, and subsequently less KIM-1 mRNA increases post injury PMID: 29074644
  5. Study used a previously described highly mobile membrane mimetic membrane in combination with a conventional lipid bilayer model to generate a membrane-bound configuration of Tim1 in silico, identified two possible states for a membrane-bound form of Tim1. PMID: 28978444
  6. Our data reveal a previously unknown role for Galpha12 in regulating efferocytosis and that renal tubular epithelial cells require KIM-1 to mediate this process. PMID: 26697979
  7. Urinary L-FABP, NGAL, Kim-1 and albumin levels increased during the acute phase of kidney injury and were significantly correlated with the degree of tubulointerstitial fibrosis during the chronic phase. These markers could detect higher risk of progression to CKD. PMID: 27028054
  8. Blockade of Tim-1 changes Th1/Th2 balance and reduces circulating regulatory T cells to enhance atherosclerosis in LDL receptor knockout mice. PMID: 26821944
  9. Our results suggest that KIM-1 is an endogenous protective mechanism against renal ischemia-reperfusion injury PMID: 25759266
  10. data suggest that TIM-1 signaling plays a direct role in Breg maintenance and induction both under physiological conditions (in response to ACs) and in response to therapy through TIM-1 ligation PMID: 25645598
  11. Deletion of the mucin domain impaired KIM-1-mediated phagocytic function, resulting in increased proinflammatory cytokine production, decreased antiinflammatory growth factor secretion by proximal epithelial cells, and an increase in tissue macrophages. PMID: 25751064
  12. Tim-1 is critical for maintaining self-tolerance by regulating IL-10 production in Bregs PMID: 25582854
  13. blood biomarker that specifically reflects acute and chronic kidney injury PMID: 24904085
  14. Tim-1 expression was lower in a herpes simplex virus-induced Behcet's disease (BD) mouse model compared to that in asymptomatic BD normal (BDN) mice. PMID: 24453431
  15. Tim-1-Fc protects cardiac grafts from chronic rejection by suppressing CD4 Th17 development and functionality. PMID: 24551271
  16. KIM-1 shedding is accelerated by worsening renal cellular injury, and excess soluble KIM-1 competitively inhibits efferocytosis. PMID: 24829508
  17. Endogenous Tim-1 promotes severe systemic autoimmunity and renal disease MRL-Fas(lpr) mice. PMID: 24623145
  18. a major P-selectin ligand with a role in T cell trafficking during inflammatory responses and the induction of autoimmune disease PMID: 24703780
  19. Sustained KIM-1 expression promotes kidney fibrosis and provides a link between acute and recurrent injury with progressive chronic kidney disease. PMID: 23979159
  20. We defined a novel pathway in which TIM-1, a receptor for phosphatidylserine expressed by apoptotic cells, drives the development of asthma by sensing and responding to injured and apoptotic airway epithelial cells. PMID: 23672783
  21. TIM-1 expressing CD4 T cells are required in the mechanism of innate immune-mediated hepatic IRI in OLTs PMID: 23137033
  22. Tim-1 plays a critical role in maintaining suppressive regulatory B-cell function, while it's mucin domain plays an unexpected role in regulating Breg function and maintaining self-tolerance. PMID: 22773818
  23. Endogenous Tim-1 promotes Th1 and Th17 nephritogenic immune responses and its neutralization reduces renal injury while limiting inflammation in cell-mediated glomerulonephritis. PMID: 22205357
  24. Tim-1 functions in pathways that suppress recruitment of inflammatory cells into the airways and the generation or activity of CD4+ T cells. PMID: 22144095
  25. Tim-1 expression declined in Helicobacter pylori infection. PMID: 21923683
  26. Data show that in vivo in mice, TIM-1 is predominantly expressed on B rather than T cells, and is an inclusive marker for IL-10+ Bregs that can be induced by TIM-1 ligation. PMID: 21821911
  27. Tim1 and Tim3 are not essential for the induction of the type-2 response in lung allergy. PMID: 21470319
  28. mAb stimulation on dendritic cells regulates the balance between effector and regulatory T cells and induces Experimental autoimmune encephalitis PMID: 21469101
  29. The TIM-1:TIM-4 pathway enhances injury after renal ischemia-reperfusion injury and may be a therapeutic target. PMID: 21355054
  30. These results suggest that TIM-1 signaling in B cells augments antibody production by enhancing B cell proliferation and differentiation. PMID: 21303660
  31. results suggest that TIM-1 serves as a pattern recognition receptor on NKT cells that senses PtdSer on apoptotic cells as a damage-associated molecular pattern PMID: 20889552
  32. Tim-1 is induced on germinal centre B cells through BCR signaling. PMID: 20518819
  33. TIM1 is an endogenous ligand for LMIR5. PMID: 20566714
  34. Late upregulation of KIM-1 and NGAL could be a useful marker for sustained renal injury after acute kidney injury. PMID: 20181666
  35. TIM1 costimulation on hepatic natural killer T cells enhances cellular production of interleukin (IL)-4 while inhibiting the production of interferon (IFN)-gamma. PMID: 20220086
  36. TIM-1 regulates not only T for the role of cell activation but may also affect macrophage function in the local inflammation response. PMID: 20091883
  37. protective effects of hepatitis A virus on atopic disease depends on a common TIM-1 allele PMID: 14534576
  38. TIM-1 is a molecule that costimulates T cell activation PMID: 15793575
  39. TIM-1-TIM-4 interaction is involved in regulating T cell proliferation PMID: 15793576
  40. TIM-1 is expressed on CD4+ T cells of the lung-draining lymph nodes after intranasal immunization and plays a role in T cell activation and differentiation. PMID: 16284246
  41. These results explain the divergent immune functions described for the murine receptors and the role of TIM-1 as a cell adhesion receptor in renal regeneration and cancer. PMID: 17363299
  42. The Ig domains of murine TIM1, 3 and 4 display calcium-dependent binding to carbohydrate ligands expressed by murine splenocytes and non-murine cell lines. Both homo- and heterotypic interactions were observed for binding between the TIM proteins. PMID: 17513880
  43. Tim-1 regulates T cell responses and can alter T cell function depending on the affinity/avidity with which it is engaged. PMID: 17606630
  44. In vivo abrogation of TIM-4 or its cognate ligand TIM-1 by using a polyclonal antibody remarkably dampened Th2 differentiation and intestinal allergy. TIM-4 as a novel molecule critically required for the development of intestinal allergy. PMID: 17915221
  45. Ligation of Tim-1 in vitro effectively deprogrammed Tregs and thus produced Tregs unable to control T cell responses. PMID: 18079964
  46. TIM-4 and TIM-1 are immunologically restricted members of the group of receptors whose recognition of PS is critical for the efficient clearance of apoptotic cells and prevention of autoimmunity. PMID: 18082433
  47. These studies define previously unknown functions of TIM-1 in regulating alloimmune responses in vivo . PMID: 18172549
  48. These results demonstrate that TIM-1 is significantly increased in pulmonary tissues and PBMCs in asthmatic mice after ovalbumin challenge, and that the production of TIM-1 as well as GATA-3 is upregulated in the spleen of asthmatic mice. PMID: 18234236
  49. Ligation of Tim-1 in the presence of mature dendritic cells triggers polyclonal T cell activation. PMID: 19155484
  50. Results demonstrate that targeting T cell Ig and mucin domain-1 (Tim-1) with anti-Tim-1 overcomes transplantation tolerance resistance. PMID: 19528638

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, TIM family
Tissue Specificity
Expressed by stimulated T-cells. Expressed during primary antigen stimulation.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*