Very nice to receive your inquiry. We use new code CSB-EP735580MO for this protein now. Please update your catalog.
The expreesion of CSB-RP171094m with N-terminal 6xHis-tagged is not very good. We have to re-develop this protein. The tag type will be determined during the production process, however, we will preferentially N-terminal 6xHis-tag. The MW and sequence info of CSB-EP735580MO with N-terminal 6xHis-tagged are as below.
1. The MW of the N-terminal 6xHis-tagged fusion protein= 27.6KD. The MW of the N-terminal 6xHis-tag is 4KD. The MW of the target protein is 23.6KD.
2. The complete sequence is as below. The sequence in front of "+" is the N-terminal 6xHis-tag sequence, and the sequence behind of "+" is the target protein sequence.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRT+YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHRVTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKVTFSLQVKPEIPTRPPTRPTTTRPTATGRPTTISTRSTHVPTSIRVSTSTPPTSTHTWTHKPEPTTFCPHE
TTAEVTGIPSHTPTDWNGTVTSSGDTWSNHTEAIPPGKPQKNPTKG
3. This protein can be used as positive control in theory. We haven't tested the activity of this protein. CSB-EP735580MO is complete Extracellular Domain which includes Ig-like V-type domain and should have activity
in theory. According to uniprot info (http://www.uniprot.org/uniprot/Q96D42), for human KIM-1, the extracellular part of the protein can be cleaved and detected in urine and is in correlation with the expression in
the kidney. The mouse KIM-1 we provide is complete Extracellular Domain which should be the cleaved product which you want.
There is an N-glycosylation at position 208 that happens to be in the extracellular domain. The recombinant expression of E. coli will have no glycosylation modification, so the peak at this glycosylation site where you take our protein as a positive control will be different from the natural sample, and everything else will be exactly the same.