Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit beta (Ms4a2), partial

Code CSB-YP015013MO1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP015013MO1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP015013MO1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP015013MO1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP015013MO1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Ms4a2
Uniprot No.
Alternative Names
Ms4a2; Fce1b; Fcer1b; Ms4a1; High affinity immunoglobulin epsilon receptor subunit beta; FcERI; Fc epsilon receptor I beta-chain; IgE Fc receptor subunit beta; Membrane-spanning 4-domains subfamily A member 2
Species
Mus musculus (Mouse)
Expression Region
192-235aa
Target Protein Sequence
IYRIGQELESKKVPDDRLYEELNVYSPIYSELEDKGETSSPVDS
Protein Length
partial, the last Cytoplasmic domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.
Gene References into Functions
  1. Analysis of the conformation and thermal stability of the high-affinity IgE Fc receptor beta chain polymorphic proteins has been presented. PMID: 26940508
  2. These observations strongly suggest a novel signaling pathway mediated by the cytoplasmic tail downstream of the FcepsilonRIbeta immunoreceptor tyrosine-based activation motif. PMID: 21683687
  3. FcRbeta is a critical element in mast cell synergistic degranulation response through FcepsilonRI & adenosine receptors. PI3K-signaling through FcRbeta-ITAM is a crucial participant in augmentation of FcepsilonRI-mediated degranulation by adenosine. PMID: 20101614
  4. inhibition of FcepsilonRI-dependent mast cell activation can suppress allergic contact dermatitis PMID: 19741711
  5. Gene expression profiling after stimulation via high-affinity Fcepsilon receptor I (FcepsilonRI), showed the transcriptional levels of several CC chemokines were markedly increased. PMID: 12393595
  6. The mouse Fc epsilon RI beta-chain gene promoter is functional only in mouse mast cell line PT18, but not in mono-macrophage and lymphoma cell lines. PMID: 12496417
  7. FcepsilonRIbeta functions to both selectively amplify (degranulation and leukotriene secretion) and dampen (lymphokine) mast cell effector responses PMID: 15355979
  8. IgE receptors are expressed on sensory neurons in mice. Immunostaining revealed that the high affinity IgE receptor FcepsilonRI was expressed in cultured dorsal root ganglion cells. PMID: 15486476
  9. FcepsilonRI beta-chain regulates calcium uptake in mast cells via the immunoreceptor tyrosine-based activation motif. PMID: 18243160
  10. IgE signaling suppresses FcepsilonRIbeta expression. PMID: 19741159

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
MS4A family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1