Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Acrosomal protein SP 10; Acrosomal protein SP-10; Acrosomal vesicle protein 1; ACRV1; ASPX_HUMAN; D11S4365; Msa63; SP 10; Sp10; SPACA2; Sperm protein 10
Species
Homo sapiens (Human)
Expression Region
22-265aa
Target Protein Sequence
QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human ACRV1 covers amino acids 22-265. The calculated molecular weight for this ACRV1 protein is 41.8 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of ACRV1, making it easier to detect and purify the ACRV1 recombinant protein in the later stages of expression and purification.
Acrosomal protein SP-10 (ACRV1) is primarily associated with research in the field of male reproduction. One of its most crucial research directions involves its function in germ cell development and sperm maturation processes. SP-10 is a key protein during sperm maturation, present in the acrosome of sperm, a structure critical in the fertilization process. Researchers focus on understanding the exact functions of SP-10 in sperm formation, motility, and fertilization to gain insights into its contributions to reproductive health. SP-10 is linked to issues with male fertility, including difficulties in achieving pregnancy and lower fertility rates. This has attracted significant attention in the fields of reproductive medicine and andrology research.
