Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant human CTD nuclear envelope phosphatase 1 protein

Product Type : Recombinant Protein
Size : 1mg
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Serine/threonine phosphatase which may be required for proper nuclear membrane morphology. Involved in LPIN1 dephosphorylation. May antagonize BMP signaling.
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP054154h
Purity : 90%
Sequence : RTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Source : E.coli
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST tagged
Mol. Weight : 54 KD
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
skype
Top