Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant human Cytochrome b5 protein

Product Type : Recombinant Protein
Code : CSB-RP031344h
Size : 1mg
Uniprot NO. : P00167
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Storage Buffer : PBS pH 7.4, 50% glycerol
Purity : 90% ( SDS-PAGE )
Sequence : AEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPEP
Research Area : Transport
Source : E.coli
Gene Names : CYB5 CYB5A
Expression Region : 2-97aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 38.5kD
Protein Description : Partial of the full length of 2-134aa
HGNC : 2570
RGD : 620558
MGI : 1926952
BIOWWW : CYB5A
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
skype
Top