Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant human Glucagon protein

Product Type : Recombinant Protein
Size : 1mg
Uniprot NO. : P01275
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Ref.9 Ref.10 Ref.11 GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton. Inhibits beta cell apoptosis. Ref.9 Ref.10 Ref.11 GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability. Ref.9 Ref.10 Ref.11 Oxyntomodulin significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness. Ref.9 Ref.10 Ref.11 Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life. Ref.9 Ref.10 Ref.11
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP089044h
Purity : 90%
Sequence : HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Research Area : Metabolism
Protocol :
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
Source : E.coli
Gene Names : GCG,Glucagon (Oxyntomodulin)
Expression Region : 53-89aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 31.8kD
Protein Description : Oxyntomodulin
Target details : This protein is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
HGNC : 4191
RGD : 2668
MGI : 95674
BIOWWW : GCG
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
skype
Top