Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant human Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 protein

Product Type : Recombinant Protein
Size : 1mg
Uniprot NO. : P62879
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP050644h
Purity : 90%
Sequence : RKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVA
Research Area : Metabolism
Source : E.coli
Gene Names : GNB2
Expression Region : 21-327aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 60.7kD
Protein Description : Partial of the full length of 21-340aa
Target details : Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5 UTR.
HGNC : 4398
RGD : 69319
MGI : 95784
BIOWWW : GNB2
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
skype
Top