Register | Sign In Professional and Accurate! We are your good partner in biology research.
cusabio

Product Name:

Recombinant human Malate dehydrogenase, cytoplasmic protein, Yeast

Product Type : Recombinant Protein
Code : CSB-YP048844h
Size : Pls inquiry other sizes
Uniprot NO. : P40925
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : Belongs to the LDH/MDH superfamily. MDH type 2 family.
Storage Buffer : PBS pH 7.4, 50% glycerol
Purity : 90% ( SDS-PAGE )
Sequence : SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Research Area : Metabolism
Source : Yeast
Gene Names : MDHA
Expression Region : 2-333aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 63.6kD
Protein Description : Full length
Target details : Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. This protein is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
HGNC : 6970
RGD : 3072
MGI : 97051
BIOWWW : MDH1
Contact us
Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.