Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant human Malate dehydrogenase, cytoplasmic protein

Product Type : Recombinant Protein
Size : 1mg
Uniprot Num : P40925
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Belongs to the LDH/MDH superfamily. MDH type 2 family.
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP048844h
Purity : 90%
Sequence : SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Research Area : Metabolism
Gene Names : MDHA
Expression Region : 2-333aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 63.6kD
Protein Description : Full length
Target details : Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. This protein is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
HGNC : 6970
RGD : 3072
MGI : 97051
BIOWWW : MDH1
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
Top