Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
ILWEQ; Talin 1; Talin; Talin-1; TLN 1; TLN; Tln1; TLN1_HUMAN
Species
Homo sapiens (Human)
Expression Region
92-399aa
Target Protein Sequence
MLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human TLN1 contains amino acids 92-399. The theoretical molecular weight of the TLN1 protein is 62.8 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of TLN1, making it easier to detect and purify the TLN1 recombinant protein in the later stages of expression and purification.
The human talin-1 (TLN1) is a cytoskeletal protein that plays a crucial role in cell adhesion by connecting integrin receptors to the actin cytoskeleton. TLN1 is essential for the formation and stabilization of focal adhesions, dynamic structures that mediate cell-extracellular matrix interactions. Through its interactions with integrins, TLN1 contributes to processes such as cell migration, spreading, and signaling. Additionally, TLN1 is involved in mechanotransduction, transmitting mechanical forces across the cell membrane. Dysregulation of TLN1 has been linked to various diseases, including cancer and cardiovascular disorders. Research on TLN1 explores its functions in cell adhesion, and signaling, and its implications in health and disease.