Register | Sign In Professional & Accurate! CUSABIO is your good partner in biology research.
cusabio

Product Name:

Recombinant human Ubiquitin-like protein ISG15 protein

Product Type : Recombinant Protein
Size : 1mg
Uniprot NO. : Q64339
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections. Ref.12 Ref.13 Ref.14 Ref.15 Ref.20 Ref.21 In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy By similarity. Ref.12 Ref.13 Ref.14 Ref.15 Ref.20 Ref.21
Storage Buffer : PBS pH 7.4, 50% glycerol
Code : CSB-RP097444h
Purity : 90%
Sequence : GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
Research Area : Immunology
Gene Names : G1P2, UCRP
Expression Region : 2-157aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : GST-tag
Mol. Weight : 44.4kD
Protein Description : Full length
Contact us
Copyright © 2007-2015 www.cusabio.com All Rights Reserved.
skype
Top