Register | Sign In Professional and Accurate! We are your good partner in biology research.
cusabio

Product Name:

Recombinant human WD repeat-containing protein 1 protein, Yeast

Product Type : Recombinant Protein
Code : CSB-YP051644h
Size : Pls inquiry other sizes
Uniprot NO. : O75083
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins By similarity.
Storage Buffer : PBS pH 7.4, 50% glycerol
Purity : 90% ( SDS-PAGE )
Sequence : HKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKE
Research Area : Signal Transduction
Source : Yeast
Gene Names : WDR1
Expression Region : 189-461aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 56.9kD
Protein Description : Partial of the full length of 2-606aa
Target details : This gene encodes a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. The encoded protein may help induce the disassembly of actin filaments. Two transcript variants encoding different isoforms have been found for this gene.
HGNC : 12754
RGD : 1305789
MGI : 1337100
BIOWWW : WDR1
Contact us
Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.