Cusabio
Product Name:

Recombinant E.coli 50S ribosomal protein L35 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP088044Ba   >>   Yeast
CSB-RP088044Ba   >>   E.coli
CSB-RP088044Ba   >>   Baculovirus
CSB-RP088044Ba   >>   Mammalian cell
Size:
1mg
Relevance:
Belongs to the ribosomal protein L35P family.
Mol. Weight:
33 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Sequence of a 1.26-kb DNA fragment containing the structural gene for E.coli initiation factor IF3: presence of an AUU initiator codon."
Sacerdot C., Fayat G., Dessen P., Springer M., Plumbridge J.A., Grunberg-Manago M., Blanquet S.
EMBO J. 1:311-3
AA sequence:
VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY