Cusabio
Product Name:

Recombinant human 39S ribosomal protein L9, mitochondrial protein for

Product Type:
Recombinant Protein
Code:
CSB-RP048644h   >>   Yeast
CSB-RP048644h   >>   E.coli
CSB-RP048644h   >>   Baculovirus
CSB-RP048644h   >>   Mammalian cell
Size:
1mg
Relevance:
Part of the 50S ribosomal subunit. Contacts L17.
Mol. Weight:
50 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Structural compensation for the deficit of rRNA with proteins in the mammalian mitochondrial ribosome. Systematic analysis of protein components of the large ribosomal subunit from mammalian mitochondria."
Suzuki T., Terasaki M., Takemoto-Hori C., H
AA sequence:
WKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLA
VYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGV
VVAPHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI