Recombinant human CTD nuclear envelope phosphatase 1 protein|cusabio.com

Cusabio

The old version of site Click here to enter >> Cusabio

Product Center

HotTopSale

Pig Substance P(SP)ELISA Kit Mouse Substance P,SP ELISA Kit Human Substance P,SP ELISA Kit Human Saliva Peroxidase(SP）ELISA Kit Human Transcription factor SOX-4(SOX4) ELISA kit Human Transcription factor SOX-2(SOX2) ELISA kit Human Sclerostin(SOST) ELISA Kit Human Sortilin(SORT1) ELISA kit Rat sorbitol dehydrogenase(SDH) ELISA Kit Human sorbitol dehydrogenase,SDH ELISA Kit Bovine Sorbitol dehydrogenase(SORD) ELISA kit Human Extracellular superoxide dismutase [Cu-Zn](SOD3) ELISA kit Rabbit Superoxide dismutase [Mn], mitochondrial(SOD2) ELISA kit Human Superoxide dismutase [Mn], mitochondrial (SOD2) ELISA kit Rat superoxide dismutase 1, soluble (SOD1) ELISA kit

Rabbit anti-Human Collagen alpha-2(IV) chain protein polyclonal Antibody;HRP conjugated Rabbit anti-Human Collagen alpha-2(IV) chain protein polyclonal Antibody;Biotin conjugated Rabbit anti-Human Collagen alpha-2(IV) chain protein polyclonal Antibody;FITC conjugated Rabbit anti-Human Tubulin beta-3 chain protein polyclonal Antibody Rabbit anti-Human Tubulin beta-3 chain protein polyclonal Antibody;HRP conjugated Rabbit anti-Human Tubulin beta-3 chain protein polyclonal Antibody;Biotin conjugated Rabbit anti-Human Tubulin beta-3 chain protein polyclonal Antibody;FITC conjugated Mouse B-cell lymphoma-extra large (Bcl-xl)ELISA kit Goat Extracellular superoxide dismutase [Cu-Zn](SOD3) ELISA kit Goat superoxide dismutase 1, soluble (SOD1) ELISA kit Goat superoxide dismutase 2, mitochondrial (SOD2) ELISA kit Human heterogeneous nuclear ribonucleoprotein L (HNRPL) antibody ELISA kit Goat Creatine kinase M-type(CKM) ELISA kit Prostaglandin E2(PGE2) human Beta-2-microglobulin protein

Recombinant E.coli 50S ribosomal protein L31 protein Recombinant human Tumor necrosis factor protein Recombinant E.coli 30S ribosomal protein S11 protein Recombinant E.coli 30S ribosomal protein S19 protein Recombinant E.coli 30S ribosomal protein S7 protein Recombinant E.coli 30S ribosomal protein S4 protein Recombinant E.coli 50S ribosomal protein L29 protein Recombinant E.coli 30S ribosomal protein S3 protein Recombinant E.coli 30S ribosomal protein S10 protein Recombinant E.coli 50S ribosomal protein L27 protein Recombinant human WD repeat-containing protein 1 protein Recombinant human Dr1-associated corepressor protein Recombinant human Ras-related protein Rab-8A protein Recombinant human Malate dehydrogenase, cytoplasmic protein Recombinant E.coli 50S ribosomal protein L36 protein

Please scan for our contact information

Home > Recombinant Protein > Recombinant human CTD nuclear envelope phosphatase 1 protein

	Product Name:	Recombinant human CTD nuclear envelope phosphatase 1 protein
	Product Type:	Recombinant Protein
	Application:	Immunogen，ELISA
	Code:	CSB-RP054154h
	Relevance:	Serine/threonine phosphatase which may be required for proper nuclear membrane morphology. Involved in LPIN1 dephosphorylation. May antagonize BMP signaling.
	Mol. Weight:	54 KD
	Product Info:	GST tagged
	Purity:	90%
	Image:
	Storage Buffer:	6M guanidine hydrochloride, 20mM Tris
	Storage:	Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
	Notes:	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
	Referrences:	[1] Keen J., Inglehearn C. Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ALA-12. Tissue: Brain. [2] "NovelFam3000 -- uncharacterized human protein domains conserved across model organisms." Kemmer D., Podowski R.M., Arenillas D., Lim J., Hodges E., Roth P., Sonnhammer E.L.L., Hoeoeg C., Wasserman W.W. BMC Genomics 7:48-48(2006) [PubMed: 16533400] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], SUBCELLULAR LOCATION, VARIANT ALA-12.
	AA sequence:	RTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETL IHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVA DKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDT ALLNLLPMLDALRFTADVRSVLSRNLHQHRLW