Recombinant Bovine Tumor necrosis factor protein|cusabio.com

Cusabio

The old version of site Click here to enter >> Cusabio

Product Center

HotTopSale

Guinea Pig Cortisol ELISA Kit Goat Cortisol ELISA Kit Fish Cortisol ELISA Kit Canine Cortisol ELISA Kit Bovine Cortisol ELISA Kit Rhinoceros Corticosterone (CORT) ELISA kit Rat Corticosterone,CORT ELISA Kit rabbit Corticosterone,CORT ELISA Kit Mouse Corticosterone,CORT ELISA Kit Chicken Corticosterone, CORT ELISA kit Human Corin ELISA Kit Human Coenzyme Q10 (CoQ10) ELISA Kit Rat Copeptin ELISA kit Mouse copeptin ELISA kit human copeptin ELISA kit

Human MORC family CW-type zinc finger protein 4(MORC4) ELISA kit Human MORC family CW-type zinc finger protein 3(MORC3) ELISA kit Human MORC family CW-type zinc finger protein 2(MORC2) ELISA kit Mouse MORC family CW-type zinc finger protein 1(MORC1) ELISA kit Human MORC family CW-type zinc finger protein 1(MORC1) ELISA kit Mouse Protein MON2 homolog(MON2) ELISA kit Human Protein MON2 homolog(MON2) ELISA kit Mouse Vacuolar fusion protein MON1 homolog B(MON1B) ELISA kit Human Vacuolar fusion protein MON1 homolog B(MON1B) ELISA kit Mouse Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit Human Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit Chicken Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit Bovine Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit Rat Mannosyl-oligosaccharide glucosidase(MOGS) ELISA kit Mouse Mannosyl-oligosaccharide glucosidase(MOGS) ELISA kit

Recombinant E.coli 50S ribosomal protein L31 protein Recombinant human Tumor necrosis factor protein Recombinant E.coli 30S ribosomal protein S11 protein Recombinant E.coli 30S ribosomal protein S19 protein Recombinant E.coli 30S ribosomal protein S7 protein Recombinant E.coli 30S ribosomal protein S4 protein Recombinant E.coli 50S ribosomal protein L29 protein Recombinant E.coli 30S ribosomal protein S3 protein Recombinant E.coli 30S ribosomal protein S10 protein Recombinant E.coli 50S ribosomal protein L27 protein Recombinant human WD repeat-containing protein 1 protein Recombinant human Dr1-associated corepressor protein Recombinant human Ras-related protein Rab-8A protein Recombinant human Malate dehydrogenase, cytoplasmic protein Recombinant E.coli 50S ribosomal protein L36 protein

Please scan for our contact information

Home > Recombinant Protein > Recombinant Bovine Tumor necrosis factor protein

	Product Name:	Recombinant Bovine Tumor necrosis factor protein
	Product Type:	Recombinant Protein
	Application:	Immunogen，ELISA
	Code:	CSB-RP084774B
	Relevance:	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
	Mol. Weight:	23 KD
	Product Info:	His tagged
	Purity:	95%
	Image:
	Storage Buffer:	20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0; 200 mM Imidazole
	Storage:	Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
	Notes:	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
	Referrences:	[1] "Cloning of two members of the TNF-superfamily in cattle: CD40 ligand and tumor necrosis factor alpha." Mertens B.E.L.C., Muriuki M., Gaidulis L. Immunogenetics 42:430-431(1995) [PubMed: 7590981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 50-233 (ISOFORM 1). Tissue: Blood. [2] "Rapid communication: single strand conformational polymorphism (SSCP) of bovine tumor necrosis factor alpha." Dietz A.B., Neibergs H.L., Womack J.E., Kehrli M.E. Jr. J. Anim. Sci. 75:2567-2567(1997) [PubMed: 9303477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 91-193. Strain: Holstein.
	AA sequence:	LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCP STPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPD YLDYAESGQVYFGIIAL