Recombinant human Tumor necrosis factor protein|cusabio.com

Cusabio

The old version of site Click here to enter >> Cusabio

Product Center

HotTopSale

Rat Kynurenine--oxoglutarate transaminase 1(CCBL1) ELISA kit Human Clara cell protein,CC16 ELISA Kit Rat cystathionine β-synthase(CBS) ELISA Kit Mouse Carbonyl reductase family member 4(CBR4) ELISA kit Human Cerebellin-2(CBLN2) ELISA kit Pig Cerebellin-1(CBLN1) ELISA kit Mouse Cerebellin-1(CBLN1) ELISA kit Rat Caveolin-1,Cav-1 ELISA KIT Mouse Caveolin-1(CAV1) ELISA kit Human Caveolin-1,Cav-1 ELISA KIT Rat Catalase (CAT) ELISA kit Human Catalase (CAT) ELISA kit Goat Catalase (CAT) ELISA kit Human calpastatin/calpain inhibitor(CAST)ELISA kit Rat Caspase-9,Casp-9 ELISA Kit

ZNF627 RGS11 KRT83 RBM39 DAB1 EMID2 TRIM29 SLC38A6 RIN2 HHAT DFNA5 RBM39 ZNF20 SLC2A9 NPFFR1

Recombinant human Transcription factor BTF3 protein Recombinant human Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 protein Recombinant human Leptin protein Recombinant human Interleukin-6 protein Recombinant human Interleukin-15 protein Recombinant human Interleukin-4 protein Recombinant human C-X-C motif chemokine 10 protein Recombinant human Heterogeneous nuclear ribonucleoprotein K protein Recombinant human 80 kDa MCM3-associated protein Recombinant human Cytochrome b5 protein Recombinant E.coli 30S ribosomal protein S2 protein Recombinant human Tumor necrosis factor receptor superfamily member 1A protein Recombinant human Ubiquitin-like protein ISG15 protein Recombinant human Glucagon protein Recombinant human Annexin A6 protein

Please scan for our contact information

Home > Recombinant Protein > Recombinant human Tumor necrosis factor protein

	Product Name:	Recombinant human Tumor necrosis factor protein
	Product Type:	Recombinant Protein
	Application:	Immunogen，ELISA
	Code:	CSB-RP074274h
	Relevance:	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
	Mol. Weight:	22 KD
	Product Info:	HIS-tagged
	Purity:	90%
	Image:
	Storage Buffer:	20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0，200 mM Imidazole
	Storage:	Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
	Notes:	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
	Referrences:	[1] "Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the human genome." Nedospasov S.A., Shakhov A.N., Turetskaya R.L., Mett V.A., Azizov M.M., Georgiev G.P., Korobko V.G., Dobrynin V.N., Filippov S.A., Bystrov N.S., Boldyreva E.F., Chuvpilo S.A., Chumakov A.M., Shingarova L.N., Ovchinnikov Y.A. Cold Spring Harb. Symp. Quant. Biol. 51:611-624(1986) [PubMed: 3555974] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "Human tumour necrosis factor: precursor structure, expression and homology to lymphotoxin." Pennica D., Nedwin G.E., Hayflick J.S., Seeburg P.H., Derynck R., Palladino M.A., Kohr W.J., Aggarwal B.B., Goeddel D.V. Nature 312:724-729(1984) [PubMed: 6392892] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. [3] "Cloning and expression in Escherichia coli of the gene for human tumour necrosis factor." Shirai T., Yamaguchi H., Ito H., Todd C.W., Wallace R.B. Nature 313:803-806(1985) [PubMed: 3883195] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. [4] "Human lymphotoxin and tumor necrosis factor genes: structure, homology and chromosomal localization." Nedwin G.E., Naylor S.L., Sakaguchi A.Y., Smith D.H., Jarrett-Nedwin J., Pennica D., Goeddel D.V., Gray P.W. Nucleic Acids Res. 13:6361-6373(1985) [PubMed: 2995927] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. [5] "Molecular cloning of the complementary DNA for human tumor necrosis factor." Wang A.M., Creasey A.A., Ladner M.B., Lin L.S., Strickler J., van Arsdell J.N., Yamamoto R., Mark D.F. Science 228:149-154(1985) [PubMed: 3856324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA].
	AA sequence:	LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCP STPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPD YLDYAESGQVYFGIIAL