Cusabio
Product Name:

Recombinant E.coli 30S ribosomal protein S7 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP085974Ba   >>   Yeast
CSB-RP085974Ba   >>   E.coli
CSB-RP085974Ba   >>   Baculovirus
CSB-RP085974Ba   >>   Mammalian cell
Size:
1mg
Relevance:
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, where it has been shown to contact mRNA. Has been shown to contact tRNA in both the P and E sites; it probably blocks exit of the E site tRNA. Ref.11

Protein S7 is also a translational repressor protein; it regulates the expression of the str operon members to different degrees by binding to its mRNA. Ref.11
Mol. Weight:
27 KD
Product Info:
HIS-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "The complete genome sequence of Escherichia coli K-12."
Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose
AA sequence:
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELEAFEVALENVRP
TVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDV
HRMAEANKAFAHYRWLSLRSFSHQAGASSKQPALGYLN