Cusabio
Product Name:

Recombinant E.coli 30S ribosomal protein S10 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP087644Ba   >>   Yeast
CSB-RP087644Ba   >>   E.coli
CSB-RP087644Ba   >>   Baculovirus
CSB-RP087644Ba   >>   Mammalian cell
Size:
1mg
Relevance:
Involved in the binding of tRNA to the ribosomes. HAMAP MF_00508
Mol. Weight:
38 KD
Product Info:
GST-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "The primary structure of protein S10 from the small ribosomal subunit of Escherichia coli."
Yaguchi M., Roy C., Wittmann H.G.
FEBS Lett. 121:113-116(1980) [PubMed: 7007073] [Abstract]
Cited for: PROTEIN SEQUENCE.

[2] "Regulation of the S10 ri
AA sequence:
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTH
LRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG