Cusabio
Product Name:

Recombinant human Malate dehydrogenase, cytoplasmic protein for

Product Type:
Recombinant Protein
Code:
CSB-RP048844h   >>   Yeast
CSB-RP048844h   >>   E.coli
CSB-RP048844h   >>   Baculovirus
CSB-RP048844h   >>   Mammalian cell
Size:
1mg
Relevance:
Belongs to the LDH/MDH superfamily. MDH type 2 family.
Mol. Weight:
63 KD
Product Info:
GST-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Molecular cloning and mapping of a human cDNA for cytosolic malate dehydrogenase (MDH1)."
Tanaka T., Inazawa J., Nakamura Y.
Genomics 32:128-130(1996) [PubMed: 8786100] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Heart.

[2] Lo
AA sequence:
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIAT
DKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTAS
KSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYE
ALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVP
DDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS