Cusabio
Product Name:

Recombinant human Transcription factor BTF3 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP017144h   >>   Yeast
CSB-RP017144h   >>   E.coli
CSB-RP017144h   >>   Baculovirus
CSB-RP017144h   >>   Mammalian cell
Size:
1mg
Relevance:
General transcription factor. BTF3 can form a stable complex with RNA polymerase II. Required for the initiation of transcription.
Mol. Weight:
44 KD
Product Info:
GST-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Sequencing and expression of complementary DNA for the general transcription factor BTF3."
Zheng X.M., Black D., Chambon P., Egly J.-M.
Nature 344:556-559(1990) [PubMed: 2320128] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
AA sequence:
TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIH
FNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDD
DEVPDLVENFDEASKNEAN