Cusabio
Product Name:

Recombinant human Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP050644h   >>   Yeast
CSB-RP050644h   >>   E.coli
CSB-RP050644h   >>   Baculovirus
CSB-RP050644h   >>   Mammalian cell
Size:
1mg
Relevance:
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Mol. Weight:
61 KD
Product Info:
GST-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Distinct forms of the beta subunit of GTP-binding regulatory proteins identified by molecular cloning."
Fong H.K.W., Amatruda T.T. III, Birren B.W., Simon M.I.
Proc. Natl. Acad. Sci. U.S.A. 84:3792-3796(1987) [PubMed: 3108879] [Abstract]
Cited for
AA sequence:
RKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVH
AIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSS
GDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINA
VAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMK
GDRAGVLAGHDNRVSCLGVTDDGMAVA