Cusabio
Product Name:

Recombinant human Interleukin-6 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP067574h   >>   Yeast
CSB-RP067574h   >>   E.coli
CSB-RP067574h   >>   Baculovirus
CSB-RP067574h   >>   Mammalian cell
Size:
1mg
Relevance:
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
Mol. Weight:
27 KD
Product Info:
HIS-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin."
Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Iwamatsu A., Tsunasawa S., Sa
AA sequence:
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKD
GCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDP
TTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM