Cusabio
Product Name:

Recombinant human Interleukin-15 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP066374h   >>   Yeast
CSB-RP066374h   >>   E.coli
CSB-RP066374h   >>   Baculovirus
CSB-RP066374h   >>   Mammalian cell
Size:
1mg
Relevance:
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Mol. Weight:
19 KD
Product Info:
HIS-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor."
Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alders
AA sequence:
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILA
NNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS