Cusabio
Product Name:

Recombinant human C-X-C motif chemokine 10 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP061074h   >>   Yeast
CSB-RP061074h   >>   E.coli
CSB-RP061074h   >>   Baculovirus
CSB-RP061074h   >>   Mammalian cell
Size:
1mg
Relevance:
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Mol. Weight:
15 KD
Product Info:
HIS-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins."
Luster A.D., Unkeless J.C., Ravetch J.V.
Nature 315:672-676(1985) [PubMed: 3925348] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
AA sequence:
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK
ERSKRSP