Cusabio
Product Name:

Recombinant human 80 kDa MCM3-associated protein for

Product Type:
Recombinant Protein
Code:
CSB-RP022444h   >>   Yeast
CSB-RP022444h   >>   E.coli
CSB-RP022444h   >>   Baculovirus
CSB-RP022444h   >>   Mammalian cell
Size:
1mg
Relevance:
May be involved in the nuclear localization pathway of MCM3.
Mol. Weight:
51 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Structure, expression, and chromosomal localization of the human gene encoding a germinal center-associated nuclear protein (GANP) that associates with MCM3 involved in the initiation of DNA replication."
Abe E., Kuwahara K., Yoshida M., Suzuki M.,
AA sequence:
NPTNPFSGQQPSAFSASSSNVGTLPSKPPFRFGQPSLFGQNSTLSGKSSGFSQVSSFPASSGVSHSSSVQ
TLGFTQTSSVGPFSGLEHTSTFVATSGPSSSSVLGNTGFSFKSPTSVGAFPSTSAFGQEAGEIVNSGFGK
TEFSFKPLENAVFKPILGAESEPEKTQSQIASGFFTFSHPISSAPGGLAPFSFPQVTSSSATTSNFTFSK
PVSSNNSLSAFT