Cusabio
Product Name:

Recombinant human Transmembrane emp24 domain-containing protein 9 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP048044h   >>   Yeast
CSB-RP048044h   >>   E.coli
CSB-RP048044h   >>   Baculovirus
CSB-RP048044h   >>   Mammalian cell
Size:
1mg
Relevance:
Belongs to the EMP24/GP25L family.
Mol. Weight:
44 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M.,
AA sequence:
FHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFT
FTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQ
KEQNYQRWREERFRQTSE