Cusabio
Product Name:

Recombinant human CTD nuclear envelope phosphatase 1 protein

Product Type:
Recombinant Protein
Code:
CSB-RP054154h   >>   E.coli
Size:
1mg
Relevance:
Serine/threonine phosphatase which may be required for proper nuclear membrane morphology. Involved in LPIN1 dephosphorylation. May antagonize BMP signaling.
Mol. Weight:
54 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] Keen J., Inglehearn C. Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ALA-12. Tissue: Brain. [2] "NovelFam3000 -- uncharacterized human protein domains conserved across model organisms."
Protocol:

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.

AA sequence:
RTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETL
IHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVA
DKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDT
ALLNLLPMLDALRFTADVRSVLSRNLHQHRLW