Cusabio
Product Name:

Recombinant Bovine Tumor necrosis factor protein

Product Type:
Recombinant Protein
Code:
CSB-RP084774B   >>   Yeast
CSB-RP084774B   >>   E.coli
CSB-RP084774B   >>   Baculovirus
CSB-RP084774B   >>   Mammalian cell
Size:
1mg
Gene Names:
TNF/TNFA/TNFSF2
Relevance:
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
Mol. Weight:
21.5kD
Product Info:
His-tag
Purity:
95%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Cloning of two members of the TNF-superfamily in cattle: CD40 ligand and tumor necrosis factor alpha." Mertens B.E.L.C., Muriuki M., Gaidulis L. Immunogenetics 42:430-431(1995) [PubMed: 7590981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF
Protocol:

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.

AA sequence:
LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCP
STPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPD
YLDYAESGQVYFGIIAL
Expression Region:
78-234aa