Cusabio
Product Name:

Recombinant E.coli 50S ribosomal protein L31 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP088444Ba   >>   Yeast
CSB-RP088444Ba   >>   E.coli
CSB-RP088444Ba   >>   Baculovirus
CSB-RP088444Ba   >>   Mammalian cell
Size:
1mg
Relevance:
Binds the 23S rRNA
Mol. Weight:
35 KD
Product Info:
GST-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes." Plunkett G. III, Burland V., Daniels D.L., Blattner F.R. Nucleic Acids Res. 21:3391-3398(1993) [PubMed: 8346018] [Abstract] Cited for: NUCLEOTIDE
AA sequence:
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK