Cusabio
Product Name:

Recombinant E.coli 30S ribosomal protein S11 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP087574Ba   >>   Yeast
CSB-RP087574Ba   >>   E.coli
CSB-RP087574Ba   >>   Baculovirus
CSB-RP087574Ba   >>   Mammalian cell
Size:
1mg
Relevance:
Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome
Mol. Weight:
21 KD
Product Info:
HIS-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Nucleotide sequence of the alpha ribosomal protein operon of Escherichia coli." Bedwell D.M., Davis G.R., Gosink M., Post L.E., Nomura M., Kestler H., Zengel J.M., Lindahl L. Nucleic Acids Res. 13:3891-3903(1985) [PubMed: 2989779] [Abstract] Cited
AA sequence:
AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCA
DAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV