Cusabio
Product Name:

Recombinant E.coli 30S ribosomal protein S19 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP086774Ba   >>   Yeast
CSB-RP086774Ba   >>   E.coli
CSB-RP086774Ba   >>   Baculovirus
CSB-RP086774Ba   >>   Mammalian cell
Size:
1mg
Relevance:
In the E.coli 70S ribosome in the initiation state (Ref.10) it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B1a; this bridge is broken in the model with bound EF-G. The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states (Ref.11), contacting alternately S13 or S19. In the 3.5 angstroms resolved ribosome structures (Ref.12) the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder. HAMAP MF_00531_B Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA. Contacts the A site tRNA. HAMAP MF_00531_B
Mol. Weight:
16 KD
Product Info:
HIS-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Structure of the Escherichia coli S10 ribosomal protein operon." Zurawski G., Zurawski S.M. Nucleic Acids Res. 13:4521-4526(1985) [PubMed: 3892488] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "The complete genome sequence of
AA sequence:
PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKL
GEFAPTRTYRGHAADKKAKKK