Cusabio
Product Name:

Recombinant E.coli 30S ribosomal protein S3 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP086344Ba   >>   Yeast
CSB-RP086344Ba   >>   E.coli
CSB-RP086344Ba   >>   Baculovirus
CSB-RP086344Ba   >>   Mammalian cell
Size:
1mg
Relevance:
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation By similarity. Ref.7 Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp. Ref.7
Mol. Weight:
53 KD
Product Info:
GST-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Structure of the Escherichia coli S10 ribosomal protein operon." Zurawski G., Zurawski S.M. Nucleic Acids Res. 13:4521-4526(1985) [PubMed: 3892488] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "The complete genome sequence of
AA sequence:
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTA
RPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNA
MRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGM
AAVEQPEKPAAQPKKQQRKGRK