Cusabio
Product Name:

Recombinant E.coli 30S ribosomal protein S10 protein

Product Type:
Recombinant Protein
Code:
CSB-RP087644Ba   >>   E.coli
Size:
1mg
Gene Names:
rpsJ/ nusE/ b3321 /JW3283
Relevance:
Involved in the binding of tRNA to the ribosomes. HAMAP MF_00508
Mol. Weight:
39.1kD
Product Info:
GST-tag
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "The primary structure of protein S10 from the small ribosomal subunit of Escherichia coli." Yaguchi M., Roy C., Wittmann H.G. FEBS Lett. 121:113-116(1980) [PubMed: 7007073] [Abstract] Cited for: PROTEIN SEQUENCE. [2] "Regulation of the S10 ri
Protocol:

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.

AA sequence:
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTH
LRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Expression Region:
1-103aa
Research Area:
Others