Cusabio
Product Name:

Recombinant human WD repeat-containing protein 1 protein

Product Type:
Recombinant Protein
Code:
CSB-RP051644h   >>   E.coli
Size:
1mg
Gene Names:
WDR1
Relevance:
Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins By similarity.
Mol. Weight:
56.9kD
Product Info:
GST-tag
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "A gene upregulated in the acoustically damaged chick basilar papilla encodes a novel WD40 repeat protein." Adler H.J., Winnicki R.S., Gong T.-W.L., Lomax M.I. Genomics 56:59-69(1999) [PubMed: 10036186] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MR
Protocol:

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.

AA sequence:
HKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDY
SGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGN
VRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCL
AWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKE
Expression Region:
189-461aa
Research Area:
Signal Transduction