Cusabio
Product Name:

Recombinant human Dr1-associated corepressor protein for

Product Type:
Recombinant Protein
Code:
CSB-RP051444h   >>   Yeast
CSB-RP051444h   >>   E.coli
CSB-RP051444h   >>   Baculovirus
CSB-RP051444h   >>   Mammalian cell
Size:
1mg
Relevance:
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Ref.1 Ref.2
Mol. Weight:
48 KD
Product Info:
GST-tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "A mechanism for repression of class II gene transcription through specific binding of NC2 to TBP-promoter complexes via heterodimeric histone fold domains." Goppelt A.R., Stelzer G., Lottspeich F., Meisterernst M. EMBO J. 15:3105-3116(1996) [PubMed
AA sequence:
KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQC
IELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDE
SEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE