Cusabio
Product Name:

Recombinant human Malate dehydrogenase, cytoplasmic protein

Product Type:
Recombinant Protein
Code:
CSB-RP048844h   >>   E.coli
Size:
1mg
Gene Names:
MDHA
Relevance:
Belongs to the LDH/MDH superfamily. MDH type 2 family.
Mol. Weight:
63.6kD
Product Info:
GST-tag
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Molecular cloning and mapping of a human cDNA for cytosolic malate dehydrogenase (MDH1)." Tanaka T., Inazawa J., Nakamura Y. Genomics 32:128-130(1996) [PubMed: 8786100] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Heart. [2] Lo
Protocol:

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.

AA sequence:
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIAT
DKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTAS
KSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYE
ALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVP
DDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Expression Region:
2-333aa
Research Area:
Metabolism