Cusabio
Product Name:

Recombinant human Heterogeneous nuclear ribonucleoprotein K protein

Product Type:
Recombinant Protein
Code:
CSB-RP025344h   >>   E.coli
Size:
1mg
Gene Names:
HNRPK HNRNPK
Relevance:
One of the major pre-mRNA-binding proteins. Binds tenaciously to poly(C) sequences. Likely to play a role in the nuclear metabolism of hnRNAs, particularly for pre-mRNAs that contain cytidine-rich sequences. Can also bind poly(C) single-stranded DNA.
Mol. Weight:
78.1kD
Product Info:
GST-tag
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Characterization and primary structure of the poly(C)-binding heterogeneous nuclear ribonucleoprotein complex K protein." Matunis M.J., Michael W.M., Dreyfuss G. Mol. Cell. Biol. 12:164-171(1992) [PubMed: 1729596] [Abstract] Cited for: NUCLEOTIDE
Protocol:

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.

AA sequence:
TEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDY
NASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSD
FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDL
ISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDD
MSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTW
SPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIK
IDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF
Expression Region:
3-459aa
Research Area:
Immunology