Cusabio
Product Name:

Recombinant human Cytochrome b5 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP031344h   >>   Yeast
CSB-RP031344h   >>   E.coli
CSB-RP031344h   >>   Baculovirus
CSB-RP031344h   >>   Mammalian cell
Size:
1mg
Relevance:
Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Mol. Weight:
38 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "The complete nucleotide sequence of human liver cytochrome b5 mRNA." Yoo M., Steggles A.W. Biochem. Biophys. Res. Commun. 156:576-580(1988) [PubMed: 3178851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. [2] "
AA sequence:
AEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTD
AREMSKTFIIGELHPDDRPKLNKPPEP