Cusabio
Product Name:

Recombinant E.coli 30S ribosomal protein S2 protein for

Product Type:
Recombinant Protein
Code:
CSB-RP086444Ba   >>   Yeast
CSB-RP086444Ba   >>   E.coli
CSB-RP086444Ba   >>   Baculovirus
CSB-RP086444Ba   >>   Mammalian cell
Size:
1mg
Relevance:
Belongs to the ribosomal protein S2P family.
Mol. Weight:
53 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Organization and nucleotide sequence of a new ribosomal operon in Escherichia coli containing the genes for ribosomal protein S2 and elongation factor Ts." An G., Bendiak D.S., Mamelak L.A., Friesen J.D. Nucleic Acids Res. 9:4163-4172(1981) [PubMed
AA sequence:
ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVG
TKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTREL
EKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVT
LYLGAVAATVREGRSQDLASQAEESFVEAE