Cusabio
Product Name:

Recombinant human Annexin A6 protein

Product Type:
Recombinant Protein
Code:
CSB-RP007944h   >>   Yeast
CSB-RP007944h   >>   E.coli
CSB-RP007944h   >>   Baculovirus
CSB-RP007944h   >>   Mammalian cell
Size:
1mg
Relevance:
May associate with CD21. May regulate the release of Ca2+ from intracellular stores.
Mol. Weight:
54 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Primary structure of the human, membrane-associated Ca2+-binding protein p68 a novel member of a protein family." Crompton M.R., Owens R.J., Totty N.F., Moss S.E., Waterfield M.D., Crumpton M.J. EMBO J. 7:21-27(1988) [PubMed: 3258820] [Abstract] C
AA sequence:
AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLI
ADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERD
LEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHL
RLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIR