Recombinant Mouse Vascular endothelial growth factor A(Vegfa),partial (Active)

In Stock
Code CSB-AP004161MO
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q00731
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF; VEGFA; VEGFA164; VEGF164
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined?in?a?cell?proliferation?assay?using?HUVEC?human?umbilical?vein?endothelial?cells?is?less than 4ng/mL, corresponding to a specific activity of ≥ 2.5 x 105 units/mg.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Research Area Cancer
Source Yeast
Gene Names Vegfa
Expression Region 27-190aa
Tag Info Tag-Free
Mol. Weight 19.27 kDa
Protein Description Partial of Isoform 2
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity). Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development
Subcellular Location Isoform VEGF-1: Secreted, SUBCELLULAR LOCATION: Isoform VEGF-2: Secreted, SUBCELLULAR LOCATION: Isoform VEGF-3: Cell membrane, Peripheral membrane protein
Protein Families PDGF/VEGF growth factor family
Tissue Specificity In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in ki
Database Links

KEGG: mmu:22339

STRING: 10090.ENSMUSP00000115883

UniGene: Mm.282184

Pathway HIF-1 signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Ras signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Rap1 signaling pathway

Related Products

Vegfa ELISA Kit

Vegfa ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.