Recombinant Human Interleukin-1 beta(IL1B) (Active)

In Stock
Code CSB-AP004221HU
Product Type Interferon
Size $137Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01584
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-1 beta; Catabolin; IL1F2; IL1B.
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to induce NFKB reporter gene expression in HEK 293 cell line is typically 142 pg/mL
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Research Area Immunology
Source E.coli
Gene Names IL1B
Expression Region 117-269aa
Tag Info Tag-Free
Mol. Weight 17.5 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.
Subcellular Location Cytoplasm, cytosol, Lysosome, Secreted, exosome, Secreted
Protein Families IL-1 family
Tissue Specificity Expressed in activated monocytes/macrophages (at protein level).
Database Links

HGNC: 5992

OMIM: 147720

KEGG: hsa:3553

STRING: 9606.ENSP00000263341

UniGene: Hs.126256

Pathway MAPK signaling pathway
Lipids and Inflammation in Atherogenesis
NF-kappa B signaling pathway
TNF signaling pathway
Necroptosis
Hematopoietic cell lineage
IL-17 signaling pathway
Inflammasome Signaling
NOD-like receptor signaling pathway
Osteoclast differentiation
Th17 cell differentiation
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Excitatory synapse pathway

Related Products

IL1B Antibodies

IL1B Antibodies for Homo sapiens (Human)

IL1B Proteins

IL1B Proteins for Homo sapiens (Human)

IL1B ELISA Kit

IL1B ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.