Recombinant Human Interleukin-12(IL12) (Active)

In Stock
Code CSB-AP004691HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P29459
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 20mMPB,150mMNaCl,pH7.4.
Alias Interleukin-12 subunit alpha;IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit;CLMF p35;IL-12 subunit p35;NK cell;IL12A ;NKSF1 stimulatory factor chain 1;
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL) is typically 0.5 ng/ml
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Research Area Immunology
Source Mammalian cell
Gene Names IL12
Expression Region 23-219aa & 23-328aa
Tag Info Tag-Free
Mol. Weight 22.5 & 34.7 kDa
Protein Description Heterodimer
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

HGNC: 5969

OMIM: 161560

KEGG: hsa:3592

STRING: 9606.ENSP00000303231

UniGene: Hs.673

Pathway Jak-STAT signaling pathway
Th1 and Th2 cell differentiation
Toll-like receptor signaling pathway

Related Products

IL12 Antibodies

IL12 Antibodies for Human

IL12 Antibodies for Homo sapiens (Human)

IL12 Antibodies for

IL12 Proteins

IL12 Proteins for Homo sapiens (Human)

IL12 ELISA Kit

IL12 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.