Recombinant Human Interleukin-12(IL12) (Active)

In Stock
Code CSB-AP004691HU
Size US$3564Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL) is typically 0.5 ng/ml
Target Names IL12
Uniprot No. P29459
Research Area Immunology
Alternative Names CLMF; CLMF p35; CLMF p40; CLMF1; CLMF2; Cytotoxic lymphocyte maturation factor 1, p35; Cytotoxic lymphocyte maturation factor 2; Cytotoxic lymphocyte maturation factor 35 kDa subunit; Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL 12A; IL 2 subunit p40; IL-12 subunit p35; IL-12A; IL-12B; IL12; IL12, p35 subunit; IL12, subunit p40; IL12A; IL12A_HUMAN; IL12B; IL35 subunit; Interleukin 12 alpha chain; Interleukin 12 beta chain; Interleukin 12 subunit beta; Interleukin 12, p40; Interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); Interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); Interleukin 12B; Interleukin-12 subunit alpha; Natural killer cell stimulatory factor 1, 35 kD subunit; natural killer cell stimulatory factor 2; Natural killer cell stimulatory factor, 40 kD subunit; NF cell stimulatory factor chain 1; NFSK; NK cell stimulatory factor chain 1; NK cell stimulatory factor chain 2; NKSF; NKSF1; NKSF2; P35
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 23-219aa & 23-328aa
Complete Sequence RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Mol. Weight 22.5 & 34.7 kDa
Protein Length Heterodimer
Tag Info Tag-Free
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Gene References into Functions
  1. These results suggest that IL-12A rs568408 may contribute to the etiology and symptoms severity of asthma, indicating its usefulness as a predictive and diagnostic biomarker of asthma. PMID: 28600552
  2. Study provides evidence that the AA genotype of IL-12A rs568408 is associated with an increased lung cancer risk among Taiwanese, especially those with smoking habits. PMID: 30396953
  3. IL-35 may have a role in renal involvement in lupus nephritis patients PMID: 29576585
  4. The IL-35 levels in CagA(+) H. pylori-infected participants from peptic ulcer and H. pylori-infected asymptomatic groups were lower than individuals infected with CagA(-) strains. PMID: 29938865
  5. these data demonstrate the expression of IL35 in oral lichen planus lesions PMID: 29633015
  6. IL-12 receptor signalling in keratinocytes initiates a protective transcriptional programme that limits skin inflammation. PMID: 27892456
  7. The present study investigated the relationship of IL35 in patients with immunorelated hemocytopenia (IRH). Serum level of IL35 was decreased in untreated patients with IRH compared with remission patients (P<0.01) and was significantly associated with clinical indexes. PMID: 29257310
  8. IL-35 may be involved in the pathogenesis of Primary biliary cirrhosis. PMID: 29445068
  9. The overall results showed that cancer risk was increased by IL-12A rs568408 (GG versus GA + AA: P = 0.004; G versus A: P = 0.005) and IL-12B rs3212227 (AA versus AC + CC: P = 0.004; CC versus AA + AC: P = 0.03; A versus C: P = 0.007) polymorphisms. However, we failed to detect any significant associations between the IL-12A rs2243115 polymorphism and cancer risk in either the overall or the subgroup analyses. PMID: 28408727
  10. IL-35 is a relatively newly discovered member of the IL-12 family which are unique in structure as they are dimer formed by two subunits; recent findings have shown abnormal expression of IL-35 in inflammatory autoimmune diseases and functional analysis suggested that IL-35 is critical in the onset and development of these diseases. [Review] PMID: 29729445
  11. The results suggest IL12A genotype predict higher risk of death and progression, respectively, in NSCLC patients. PMID: 28807247
  12. IL-35 expression was significantly increased in patients with chronic hepatitis C and was positively correlated with the levels of viral RNA PMID: 28644966
  13. Pancreatic ductal carcinoma cells produce IL35 to recruit monocytes via CCL5 and induce macrophage to promote angiogenesis via expression of CXCL1 and CXCL8. PMID: 28989066
  14. Polymorphisms of IFNL3 rs8099917 and IL12A rs568408 contribute to survival of HD patients, but not as independent factors. PMID: 28525983
  15. The anti-EGFR viroplexes with IL-12 and salmosin genes exhibited the most effective therapeutic efficacy in a mouse tumor model, especially when combined with doxorubicin. PMID: 27191929
  16. baseline serum IL-12 levels were significantly higher in those pediatric hematopoietic stem cell transplantation recipients who did not develop acute graft versus host disease PMID: 27751764
  17. Our data indicated that decreased expression of IL-35 in tumor tissues might contribute to the progression of hepatocellular carcinoma PMID: 27329841
  18. circulating mir-21 and expression of the IL-12p35 gene were observed significantly downregulated in current smokers with CAD. PMID: 27765464
  19. Simultaneous elevated circulating levels of IL-18 and IL-12 increased the event rate after 2 years in Coronary Artery Disease patients, independent of hyperglycemia PMID: 27058587
  20. The study revealed that post-therapeutic recovery of circulating IL-35 concentration might be an independent predictor for effective response to IST in pediatric AA. PMID: 28211781
  21. Epstein Barr Virus miRNAs collectively and specifically suppress release of proinflammatory cytokines such as IL-12, repress differentiation of naive CD4(+) T cells to Th1 cells. PMID: 27621419
  22. assembly-induced folding is key in IL-12 family biogenesis and secretion; the identification of essential disulfide bonds that underlie this process lays the basis for a simplified yet functional IL-12 cytokine PMID: 28325840
  23. The plasma levels of interleukin-35 were significantly higher in the hepatocellular carcinoma patients than the controls. PMID: 27699510
  24. Importantly, treatment of NK cells from HIV-infected patients with IL-12 reversed the multiple defects in binding, granule polarization, perforin content, and perforin release and restored anticryptococcal activity. PMID: 27555306
  25. The results of this case-control study suggest that IL-12A, IL-12B, IL12RB1, IL12RB2 and IL23R make no genetic contribution to the susceptibility of Takayasu arteritis in Chinese populations PMID: 26987707
  26. this study introduces IL-35 as a new treatment for pemphigus PMID: 27855302
  27. suberoylanilide hydroxamic acid significantly inhibited IL-12p40 and IL-23p19 mRNA synthesis and did not change IL-12p35 mRNA transcription. PMID: 27240992
  28. this study shows that IL-12A gene polymorphism contributes to the risk of hepatocellular carcinoma on top of chronic hepatitis C virus infection in Egyptian patients PMID: 27819525
  29. The results suggest that hepatocellular carcinoma (HCC). cell apoptosis was suppressed at least partially through HBx-induced miR-21 by targeting IL-12. PMID: 27571873
  30. These data indicate that increased serum IL-35 could act as a disease activity marker and as a risk factor for esophageal involvement in idiopathic inflammatory myopathies. PMID: 27502600
  31. The results of Expression Quantitative Trait Loci analysis showed that the risk alleles of rs4679868 and rs6441286 were significantly associated with decreased expression of IL12A in lymphoblastoid cell lines derived from individuals of Chinese Han ancestry. These results demonstrated that IL12A is associated with Primary Biliary Cirrhosis in the Chinese Han population. PMID: 27175695
  32. The highest gene transfer ability was achieved by the DTPA-conjugated PEI at the conjugation degree of 0.1 % where the level of IL-12 production increased up to twofold compared with that of the unmodified PEI PMID: 26801817
  33. TLR3 is required to induce full IL-12p70 secretion. PMID: 26956584
  34. Interleukin-12 A rs17810546 was positively associated with celiac disease. PMID: 27043536
  35. Data show that interleukin-35 (Epstein-Barr virus-induced gene 3 (EBI3) and the interleukin-12 Subunit p35 (p35) subunit) levels were significantly elevated in the patients with influenza infection. PMID: 26844658
  36. the functional single nucleotide polymorphism IL-12A rs2243115 GG genotype may increase the risk of rheumatoid arthritis in rheumatoid factor negative patients PMID: 26375522
  37. Low IL12 expression levels are associated with Acute Leukemia. PMID: 26514528
  38. Study indicated that the rs568408 variation in IL-12A gene could influence disease susceptibility, and was associated with the severity of oral lichen planus in our East Chinese cohort. PMID: 25258182
  39. These results for the first time demonstrate a role of Cdk5/p35 in the regulation of cell cycle progression modulated by TGF-beta1. PMID: 26966064
  40. IL-35 was elevated in bone marrow of adult AML patients and this increase was correlated with the clinical stages of malignancy, suggesting that IL-35 is involved in pathogenesis of AML. PMID: 26431888
  41. p41 fragment is also shown to reduce the secretion of interleukin-12 (IL-12/p70) during the subsequent maturation of treated dendritic cells. PMID: 26960148
  42. IL-35 plays a protective role in the pathogenesis of rheumatoid arthritis PMID: 26370008
  43. Findings demonstrate that IL-12 is increased significantly in chronic hepatitis B patients and that viral protein HBx induces IL-12 expression in hepatocytes through the activation of the PI3K/Akt pathway. PMID: 26062743
  44. Serum levels of IL-35 increased in normal pregnancy and decreased in recurrent spontaneous abortion. PMID: 26042836
  45. IL-35 Is Involved in the Pathogenesis of Guillain-Barre Syndrome Through Its Influence on the Function of CD4+ T Cells PMID: 26225474
  46. Elevated circulating IL-35, particularly at early phase, its decrease after treatment initiation, and a positive association between synovial fluid IL-35 and disease activity support an involvement of IL-35 in the pathogenesis of RA. PMID: 26204444
  47. Gene-gene interaction analysis showed that subjects carrying the IL-12A rs568408AG/AA and IL-12B rs3212227AA genotypes had a 2.40-fold increased risk of CRC (OR = 2.40; 95 % CI, 1.14-5.07) PMID: 26104769
  48. the distribution of interleukin (IL)-12 (IL12; 1188A/C), IL17 (A7488G) and IL-23 receptor (IL23R; +2199A/C) gene polymorphisms in patients with alopecia areata, was investigated. PMID: 26017027
  49. Genome-wide association study in an admixed case series reveals IL12A as a new candidate in Behcet disease PMID: 25799145
  50. These results might indicate an important new role for IL-35 as an autocrine growth factor in pancreatic cancer growth. PMID: 25073578
  51. IL-35 over-expression is associated with genesis of gastric cancer. PMID: 25854372
  52. IL-35 mRNA and protein were higher in tuberculous pleural effusions than in malignant ones. PMID: 25935866
  53. increased serum IL-35 could be directly related to increased levels of IL-35 mRNA in CD4(+) T cells and hepatitis B virus DNA load in chronic hepatitis B patients. PMID: 25752977
  54. IL-35 might play an important role in rheumatoid arthritis pathogenesis. PMID: 25697137
  55. A significant and positive correlation was identified between plasma concentrations of IL-35 and disease severity score in asthmatic patients. PMID: 25326182
  56. IL-35 can effectively suppress the proliferation and IL-4 production of activated CD4+CD25- T cells in allergic asthma, and that IL-35 may be a new immunotherapy for asthma patients. PMID: 26044961
  57. IL-35 is highly expressed in chronic HBV CD4(+) T-cells and plays an important role in the inhibition of the cellular immune response in chronic HBV. PMID: 25869609
  58. IL-12 can induce monocytic tumor cells directional differentiation into macrophage-like cells. PMID: 25563480
  59. Insight into the control of vascular inflammation by IL-35. PMID: 26085094
  60. IL-35 might suppress T cell activation during the peripheral immune responses of rheumatoid arthritis. PMID: 25731770
  61. IL-35 contributed to the establishment and maintenance of maternal-fetal tolerance during early pregnancy. PMID: 25611266
  62. Glucose increases the IL-12 production in stimulated PBMCs of diabetes patients through increased IL-12 gene expression PMID: 25179705
  63. DN was associated with enhanced Th1 response and suppression of Th2 responses which might be due to inreased levels of IL-12 and decreased levels of IL-33 cytokines respectively. PMID: 25550844
  64. The levels of EBI3 and IL-12p35 mRNAs in peripheral blood mononuclear cells in moderate or hyper-responders were significantly higher than those in non- or hypo-responders. PMID: 25575066
  65. we demonstrate that IL-12p35 is required for tolDCs to reach their full suppressive potential. PMID: 25820702
  66. The results suggest that the decreased expression of IL-35 could be involved in the pathogenesis of childhood asthma. PMID: 24970690
  67. IL-35 is a promising potential biomarker in prognostication of clinical outcome of NSCLC patients and the regulation of IL-35 expression may provide a new target for the treatment of NSCLC patients PMID: 25480413
  68. IL-17 and IL-35 may be critically involved in the pathogenesis of hepatitis B-related LC. PMID: 25323532
  69. IL35 appears to contribute to the loss of immunological self-tolerance in ITP patients by modulating T cells and immunoregulatory cytokines. PMID: 25640666
  70. IL-35 and IL-37 protein expressions were higher in IBD patients compared with controls. PMID: 25214710
  71. No significant association was observed between rs2243115 in IL-12A and RA PMID: 25469793
  72. IL-35 levels are dramatically decreased in immune thrombocytopenia patients, suggesting that IL-35 may be involved in the pathogenesis of this disease. PMID: 24994465
  73. the impairment of IL-12p35 expression during the neonatal period might be caused by other epigenetic regulation occurs in the chromatin level. PMID: 25139335
  74. Data show that dsFvalpha gene and interleukin 12 (IL-12) gene were successfully expressed in the supernatant of transfected cells. PMID: 25200154
  75. In human breast cancer, expression of IL12A and cytotoxic effector molecules are predictive of pathological complete response rates to paclitaxel. PMID: 25446896
  76. NK cell activity in children with IDDM after in vitro stimulation by IL12 inhibits autoimmunity by increased IL10 synthesis. PMID: 25577895
  77. The expression levels of GOLPH2 and IL-12A were negatively correlated. PMID: 24289573
  78. Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner PMID: 25202013
  79. We investigated the relations of three potentially functional single nucleotide polymorphisms (SNPs) in IL-12A (rs2243115 and rs568408) and IL-12B (rs3212227) with late-onset Alzheimer's disease. PMID: 25037175
  80. ingestion of apoptotic cells by DCs leads to increased expression of IL-12p35 and Ebi3 without affecting IL-12p40. PMID: 24782489
  81. circulating IL-35 in PDAC patients significantly increased, suggesting that regulating the expression of IL-35 may provide a new possible target for the treatment of PDAC patients, especially for the resectable ones. PMID: 24121041
  82. The increased expression of IL-35 in chronic and aggressive periodontitis suggests its possible role in pathogenesis of periodontitis. PMID: 24376289
  83. The IL-12A rs568408 and IL-12B rs3212227 polymorphisms were analyzed in relation to anti-hepatitis B antigens development in 602 hemodialysis patients. PMID: 24158609
  84. Data suggest that IL-15 may improve the cytotoxicity of CIK cells against leukemia cells by upregulating CD3CD56 cells and downregulating Treg cells and IL-35. PMID: 24145357
  85. IL-12 and IL-18 are elevated during the earlier stages of Chronic kidney disease but are not associated with arterial stiffness. PMID: 23778029
  86. stimulated human peripheral blood T cells of healthy donors produce high amounts of IL-35 protein. However, the biological function of this cytokine remains to be elucidated. PMID: 23714111
  87. IL-35 could be a valuable biomarker for assessing colorectal carcinoma progression and prognosis in clinical settings. PMID: 24040445
  88. in contrast to TGF-beta, IL-35 is not constitutively expressed in tissues but it is inducible in response to inflammatory stimuli PMID: 22438968
  89. TGF-beta1 blockade and IL-12p70 production augments antitumor immunity in tumor and dendritic cell fusions. PMID: 23717436
  90. IL-35 is an anti-inflammatory cytokine comprising the p35 subunit of IL-12 and the subunit Epstein-Barr virus (EBV) -induced gene 3(EBI3)--{REVIEW} PMID: 24273881
  91. Poor nutritional status and frailty in subjects over 75 years were associated with decreased IL-12p70 and IL-23 production. PMID: 23755218
  92. Data indicate that IL-12 increased after surgery in 38 of 52 cases. PMID: 23734222
  93. expressed by trophoblast cells PMID: 23619469
  94. Alpha-nac is a potent inducer of a Th1 response via IL12 and TLR2. PMID: 23657466
  95. Serial determinations of serum IL-10 and IL-12 reflected well the course of STS in children and enabled remission and relapse phases to be distinguished. To avoid G-CSF and sepsis influence. PMID: 23752604
  96. The results of the present study show that circulating IL-35 is a potentially novel biomarker for coronary artery disease. PMID: 23285065
  97. These findings suggest that Tim-3-mediated differential regulation of IL-12/IL-23 drives T(H)17 cell development, a milieu favoring viral persistence and autoimmune phenomenon during chronic hepatitis C. PMID: 23388728
  98. these results reveal a novel functional role for IL-35 in suppressing cancer activity, inhibiting cancer cell growth, and increasing the apoptosis sensitivity of human cancer cells through the regulation of genes related to the cell cycle and apoptosis. PMID: 23154182
  99. The p40 subunit of interleukin (IL)-12 promotes stabilization and export of the p35 subunit: implications for improved IL-12 cytokine production. PMID: 23297419
  100. Autoimmune diseases appear to cluster in two groups that either show strong associations with the Th1/Th17 pathway (IL12B and IL23R) or the Th1/IL-35 pathway ( polymorphisms in the IL12A gene region). Review PMID: 22819329

Show More

Hide All

Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

HGNC: 5969

OMIM: 161560

KEGG: hsa:3592

STRING: 9606.ENSP00000303231

UniGene: Hs.673

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1