Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004611HU |
| Product Type | Interleukin |
| Size | US$130 |
| Uniprot No. | P10145 |
| Lead Time | 5-10 business days |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alias | Interleukin-8; IL-8; C-X-C Motif Chemokine 8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1; Protein 3-10C; T-Cell Chemotactic Factor; IL8; CXCL8 |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 5 ng/mL. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Research Area | Immunology |
| Source | E.coli |
| Gene Names | CXCL8 |
| Expression Region | 28-99aa |
| Tag Info | Tag-Free |
| Mol. Weight | 8.45 kDa |
| Protein Description | Partial |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. |
| Subcellular Location | Secreted |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Database Links |
HGNC: 6025 OMIM: 146930 KEGG: hsa:3576 STRING: 9606.ENSP00000306512 UniGene: Hs.624 |
| Pathway |
Chemokine signaling pathway
NF-kappa B signaling pathway Cellular senescence IL-17 signaling pathway NOD-like receptor signaling pathway Toll-like receptor signaling pathway AGE-RAGE signaling pathway in diabetic complications Oxidative Phosphorylation Phospholipase D signaling pathway |
CXCL8 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-MA083271A0m | CXCL8 Monoclonal Antibody | Human | ELISA,IHC |
| CSB-PA08327B0Rb | CXCL8 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA08327C0Rb | CXCL8 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA08327D0Rb | CXCL8 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA011671GA01HU | CXCL8 Antibody | Human | ELISA,IHC |
| CSB-PA003036 | CXCL8 Antibody | Human | WB,IHC,ELISA |
| CSB-PA004977 | CXCL8 Antibody | Human | WB,ELISA |
| CSB-PA009564 | CXCL8 Antibody | Human | IHC,ELISA |
CXCL8 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA08327A0Rb | CXCL8 Antibody | Human | ELISA, WB, IHC |
| CSB-PA08329A0Rb | CXCL8 Antibody | Human | ELISA, IF |
| CSB-PA08329B0Rb | CXCL8 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA08329C0Rb | CXCL8 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA08329D0Rb | CXCL8 Antibody, Biotin conjugated | Human | ELISA |
CXCL8 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-AP004621HU | Recombinant Human Interleukin-8(CXCL8) | E.coli |
| CSB-AP004641HU | Recombinant Human Interleukin-8(CXCL8) | Mammalian cell |
| CSB-YP011671HU | Recombinant Human Interleukin-8(CXCL8) | Yeast |
| CSB-AP001771HU | Recombinant Human Interleukin-8 protein(CXCL8) (Active) | E.coli |
| CSB-AP001761HU | Recombinant Human Interleukin-8 protein(CXCL8) (Active) | E.coli |
| CSB-RP083274h | Recombinant Human Interleukin-8(CXCL8),partial | E.coli |
| CSB-EP011671HU CSB-BP011671HU CSB-MP011671HU |
Recombinant Human Interleukin-8(CXCL8) | E.coli Baculovirus Mammalian cell |
CXCL8 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E04641h | Human Interleukin 8,IL-8 ELISA KIT | serum, cell culture supernates, saliva, urine, cerebrospinal fluid (CSF), tissue homogenates, cell lysates | 7.110 pg/mL |
Recombinant Human Electron transfer flavoprotein subunit alpha, mitochondrial(ETFA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Heterogeneous nuclear ribonucleoprotein L(HNRNPL),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ornithine decarboxylase(ODC1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Macrophage mannose receptor 1(MRC1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Myeloid leukemia factor 1(MLF1)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.