Code | CSB-AP004611HU |
Size |
$130Purchase it in Cusabio online store (only available for customers from the US) |
Image |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 5 ng/mL. |
Target Names | CXCL8 |
Uniprot No. | P10145 |
Research Area | Immunology |
Alternative Names | Interleukin-8; IL-8; C-X-C Motif Chemokine 8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1; Protein 3-10C; T-Cell Chemotactic Factor; IL8; CXCL8 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 28-99aa |
Complete Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Mol. Weight | 8.45 kDa |
Protein Length | Partial |
Tag Info | Tag-Free |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. |
Subcellular Location | Secreted |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database Links |
HGNC: 6025 OMIM: 146930 KEGG: hsa:3576 STRING: 9606.ENSP00000306512 UniGene: Hs.624 |
Recombinant Pig Epididymal secretory glutathione peroxidase(GPX5)
Express system: E.coli
Species: Sus scrofa (Pig)
Recombinant Human BPI fold-containing family A member 2(BPIFA2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Protein phosphatase 1A(PPM1A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Interferon regulatory factor 8(Irf8)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Methionine aminopeptidase 2(METAP2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human V-type proton ATPase subunit d 1(ATP6V0D1)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide